PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00008.1.g03190.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 320aa    MW: 34665 Da    PI: 9.859
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00008.1.g03190.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-333589155
                         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                    kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Zjn_sc00008.1.g03190.1.sm.mkhc 35 KPRLRWTAELHDRFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 89
                                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-323292IPR009057Homeodomain-like
PROSITE profilePS5129412.4573292IPR017930Myb domain
SuperFamilySSF466896.63E-173491IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-243590IPR006447Myb domain, plants
PfamPF002491.8E-83787IPR001005SANT/Myb domain
PfamPF143791.3E-23126171IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MFPSNSKKHS TASSNDRPMC VQGDSGGLVL TTDPKPRLRW TAELHDRFVD AVAQLGGPDK  60
ATPKTIMRVM GVKGLTLYHL KSHLQKFRLG KQQKEFGDHS ALMEMQRNVA SSSGAMARSM  120
SDRSVDVNEA LRIQMEVQRR LHGELEVQKH LQMRVEAQGK YMQSILEKAY QAIGSSEFAT  180
WPSGYKSLGI QAAALDIGGS SSMGFSSLQD LHFYGGSSSS YMDQHQPIMD HTFLTLGESG  240
AGTAAAGSSA SKKGPAASSS NHCSSTSNSS MMWAGGEEQA KNAAATGQQL QMGSSSTSVM  300
DKRVRWRCKA DHVVRRVDGQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9690501e-162EU969050.1 Zea mays clone 325800 myb family transcription factor-related protein mRNA, complete cds.
GenBankKJ7280541e-162KJ728054.1 Zea mays clone pUT6200 G2-like transcription factor (GLK34) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700824.11e-151PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK51e-83APL_ARATH; Myb family transcription factor APL
TrEMBLK3XY571e-151K3XY57_SETIT; Uncharacterized protein
STRINGSi006865m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.23e-76G2-like family protein